zainab waheed | Lahore College For Women University Lahore Pakistan (original) (raw)

Papers by zainab waheed

Journal of City Climate Policy and Economy

This commentary by a youth leader from Pakistan discusses how the Global South has disproportiona... more This commentary by a youth leader from Pakistan discusses how the Global South has disproportionately received the worst impacts of climate change and how, if not stemmed, the effects of climate change will lead to destruction that will render the earth uninhabitable. As warned by climate scientists, global emissions must be drastically reduced to ensure the earth does not heat up beyond 1.5°C. Discrepancies between the abilities of the Global North and Global South to combat and cope with the climate crisis need to be accounted for when international bodies decide on the best strategies to halt the catastrophic impacts of the climate breakdown. The commentary also discusses the historical roots of climate change in colonialism, and voices the youth’s demand for climate justice and climate action.

Zenodo (CERN European Organization for Nuclear Research), Jun 23, 2022

Melia azedarach is a medicinal plant utilized for the treatment of various disorders in Asian cou... more Melia azedarach is a medicinal plant utilized for the treatment of various disorders in Asian countries. The antioxidant potential of fruit-seeds from this plant was investigated using n-hexane, chloroform, methanol and aqueous extracts. Preliminary studies were performed on powder as well as on various extracts. An in vitro anti-oxidant activity was evaluated using DPPH, ABTS and TAC assays. All aforementioned extracts were rich in flavonoids and polyphenols. The aqueous extract (61.30 ± 3.55%) showed high DPPH scavenging activity followed by methanol (52.95% ± 0.53%), chloroform (52.61 ± 3.59%), and n-hexane extract (51.16 ± 1.70%). Similarly, all the extracts exhibited high ABTS scavenging activity. However, in TAC assay, chloroform extract (81.16 ± 1.09%) exhibited the highest inhibitory activity, followed by aqueous, methanol and n-hexane. Therefore, further isolation and characterization of the plant is required to explore the bioactive compounds for their anti-oxidant activity.

Pakistan Journal of Medical and Health Sciences

To analyze the student`s perception of the effectiveness of online versus campus-based teaching. ... more To analyze the student`s perception of the effectiveness of online versus campus-based teaching. A descriptive cross-sectional study was conducted on students of Bachelor of Dental Surgery from College of Dentistry, Sharif Medical and Dental College Lahore. Dental students from all four years were included in the study irrespective of their academic records. Students who did not attend the online classes or refused to give consent were excluded from the study sample. A pre-validated questionnaire with a Cronbach alpha of 0.94 was used. The difference in the mean rank score across different student perceptions of the effectiveness of online in comparison to campus-based teaching was significant for motivational problems and time interruptions (p≤0.001) while non-significant for instructor and personal problems (p=0.437), lack of support services (p=0.942), lack of pre-requisite skills (p=0.218), technical problems (p=0.238) and lack of social interaction (p=0.187). The difference in ...

BackgroundTp53 gene encodes a tumor suppressor protein containing transcriptional activation, DNA... more BackgroundTp53 gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoformsAim of studyThe study is aimed to study the effect of some protein coding SNPs on human health and if it benign or neutral by using different bioinformatics tools (I-MUTANT 3. 0,PROVEAN,and SNPS&GO; PhD-snp)ResultsThe result shows that the protein sequence identification was as the following:MAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDR...

Background:Homo sapiens cell division cycle 73 (CDC73)Enables RNA polymerase II complex binding a... more Background:Homo sapiens cell division cycle 73 (CDC73)Enables RNA polymerase II complex binding activity. Involved in several processes, including histone ubiquitination; negative regulation of cell population proliferation; and regulation of cell cycle G1/S phase transition. Located in cytosol and nucleoplasm. Part of Cdc73/Paf1 complex. Implicated in hyperparathyroidism and parathyroid carcinoma. Biomarker of carcinoma (multiple) and colorectal cancer,This gene encodes a tumor suppressor that is involved in transcriptional and post-transcriptional control pathways. The protein is a component of the the PAF protein complex, which associates with the RNA polymerase II subunit POLR2A and with a histone methyltransferase complex. This protein appears to facilitate the association of 3' mRNA processing factors with actively-transcribed chromatin. Mutations in this gene have been linked to hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid...

Pakistan Journal of Medical and Health Sciences

This study aimed to determine the effectiveness of aromatherapy and music therapy in managing den... more This study aimed to determine the effectiveness of aromatherapy and music therapy in managing dental anxiety and pain among restorative dental patients in Peshawar, Pakistan. Sixty dental patients were selected after strictly following the inclusion and exclusion criteria. Informed consent was taken from the patients and instructed on the study protocols. Two groups were formed. One group had aromatherapy during the dental procedure, and the other had music therapy. The dental anxiety scale revised, present pain intensity and pain severity were used as the measuring tools in the study. SPSS 23 was used for statistical analysis. Chi-square and Mann-Whitney U tests were used for the analysis of the results. The association between pain intensity of dental patients with aromatherapy and music therapy was not significant. The percentage of discomforting pain in patients after aromatherapy was higher than in music therapy, while a higher percentage of patients were completely pain-free a...

Pakistan Journal of Medical and Health Sciences

Objective: To assess the impact of socio-demographic factors on different personality types in in... more Objective: To assess the impact of socio-demographic factors on different personality types in individual. Methodology: A Cross-sectional descriptive study was conducted in College of Dentistry, Sharif Medical and Dental College, Lahore over a period of 5 months from July to November 2021. Data was collected using a ten-item personality inventory scale (TIPI). The sociodemographic variables included age, gender, marital status, occupation and educational level. All individuals irrespective of their age and gender were included in the study. Individuals with a history of psychiatric illness were excluded from the study. Results: There was a statistically significant difference in conscientiousness personality traits among age groups (p=0.006). Similarly, the difference in the personality trait of agreeableness (p≤0.001), conscientiousness (=0.016), and emotional stability (p=0.007) across gender was statistically significant. There was also a statistically significant difference in t...

Pakistan Journal of Medical and Health Sciences

Objective: This study aimed to evaluate the association and psychological profile, including depr... more Objective: This study aimed to evaluate the association and psychological profile, including depression, anxiety, stress, and personality type (Type A and Type B), with the academic performance of the medical students. Methodology: It was a cross-sectional study conducted at different medical colleges in Peshawar. The data was collected from the final year students of MBBS. A total of 325 students participated in the study. Informed consent was taken from the participants. The academic performance (Success and failure) was documented through the annual result sheets of the students. Jenkin's Personality Survey Questionnaire evaluated personality types, and Depression Anxiety Stress Scale-21 (DASS-21) was used to assess stress, anxiety, and depression. The data was entered and analyzed on SPSS 26. Results: Out of 325 students, 199 were male, and 126 were female. Type A personality students (88.8%) had a high success percentage of academic performance as compared to Type B persona...

˜Al-œKhawarizmi engineering journal, 2011

A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-... more A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-T6 (Al-Mg-Zn), adopting friction stir welding (FSW) technique and conventional metal inert gas (MIG) technique, is well achieved in this work for real comparison purposes. The essences of present output findings were concentrated upon the FSW samples in respect to that MIG ones which can be summarized in the increase of the ultimate tensile strength for FSW was 340 MPa while it was 232 MPa for MIG welding, where it was for base metal 400 MPa. The minimum microhardness value for FSW was recorded at HAZ and it was 133 HV0.05 while it was 70 HV0.05 for MIG weld at the welding metal. The FSW produce 2470 N higher than MIG welding in the bending test and a decrease in the localized grain size for FSW in the stirred zone 12 µm and it was 37 µm for MIG while it was 32 µm for the base metal.

Journal of Rehman College of Dentistry, 2021

Objectives: To evaluate the detrimental impact of smoking on oral health.Methodology: A Cross sec... more Objectives: To evaluate the detrimental impact of smoking on oral health.Methodology: A Cross sectional comparative study was carried out on 100 patients, 50 smokers and 50 non-smokers, visitingSharif Medical and Dental College, Lahore from June 2019 to July 2020. Intra-oral examination was done using the CommunityPeriodontal Index of Treatment Needs (CPITN). Recorded data was coded, entered and analyzed using SPSS statistical Packageversion 23.ResultsThe periodontal health was significantly associated with status of smoking (p=0.001). The most prevalent periodontal problemsof smokers were periodontal pockets of 4 to 5 mm (19%) while the least (4%) had bleeding on probing. Majority of the nonsmokers(32%) had bleeding on probing. The number of cigarettes smoked in a day and periodontal health status weresignificantly associated (p=0.004). Light smokers (1 to 10 cigarettes/day) had periodontal pockets of 4 to 5mm as their biggestperiodontal problems (38%) while the least (8%) had blee...

Al-Khawarizmi Engineering Journal, 2011

A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-... more A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-T6 (Al-MgZn), adopting friction stir welding (FSW) technique and conventional metal inert gas (MIG) technique, is well achieved in this work for real comparison purposes. The essences of present output findings were concentrated upon the FSW samples in respect to that MIG ones which can be summarized in the increase of the ultimate tensile strength for FSW was 340 MPa while it was 232 MPa for MIG welding, where it was for base metal 400 MPa. The minimum microhardness value for FSW was recorded at HAZ and it was 133 HV0.05 while it was 70 HV0.05 for MIG weld at the welding metal. The FSW produce 2470 N higher than MIG welding in the bending test and a decrease in the localized grain size for FSW in the stirred zone 12 µm and it was 37 µm for MIG while it was 32 µm for the base metal. Keyword: FSW friction, stir welding, solid state, MIG metal inert gas, fusion, mechanical properties.

Basrah Journal of Veterinary Research, 2010

In this study 15 rabbits were divided into three groups ,each group contain five rabbit were subm... more In this study 15 rabbits were divided into three groups ,each group contain five rabbit were submitted to surgical section in the skin layer 3-5 cm long after anasethesia and cleaning the part from the hair by sheaving. The surgical section was made by scable and then the wound sutured by silk band 2.5 cm and then administrated the dexamethasone 1 mg / Kg body weight of animals of second and third grougs of this study. After that the skin spicemen were taken for histopathological sections to preperd slid. The first group was considered as control with no administrated of dexamthasone , the second group treated as 1 mg / Kg body weight dexamthasone and sections were taken after 7th days , the third group were also treated with dexamthasone at the 1 mg /Kg and the skin sample were taken after 14 th days. The present study it was found that dexamthasone have no effect on the wound healing after 7th days or 14th days but the collagenization , epithelization and fibroblast content were less in the dexamthasone group compered with control group. The vasicularity and the degree of inflammatory cells were more intense in the dexamthasone group compared with control group.

Journal of Gandhara Medical and Dental Science, 2019

OBJECTIVES: The study aim was to determine the feedback regarding the environment, satisfaction a... more OBJECTIVES: The study aim was to determine the feedback regarding the environment, satisfaction and further needs for modification in improving the effectiveness of the lecture. METHODOLOGY: It was a cross-sectional study to measure the student's feedback about lecture rooms to improve the effectiveness of the lectures. A questionnaire was designed to assess the student's response about the environment of the lecture room, the learning experience of the students, needs of other lecture rooms’ modification, seating design and temperature of the lecture room. The total numbers of the participants were 115 students including both genders from Sardar Begum Dental College, Peshawar. Second- and fourth-year professional students were excluded from the study. Responses were recorded from 115 participants of the first- and third-year students of BDS. The obtained data were analyzed using SPSS 20. RESULTS:This study results showed that 100% of the students were satisfied with the env...

IOP Conference Series: Materials Science and Engineering, 2019

The aimed of study to examined female reproductive system grossly and histopathological to study ... more The aimed of study to examined female reproductive system grossly and histopathological to study of lesion causes infertility or sterility in ewes. This study was conducted on the genital tract of 80 ewes in Basra province. The specimen were randomly collected from Basra slaughter house of different areas of Basra city (Qurna, Zubear, Karma Ali, Abu AL khasab, Hayaniya, alder, Shatt al-Arab)within the period from October 2014 to January 2015.The gross examination of collected specimen was confirmed histologically, pathological changes were found in 28 (35%) of the total cases. and 52 (65%) samples normal. Uterine abnormalities comprised (57.14%), whereas ovarian abnormalities comprised (39.29%) and oviduct abnormalities were (3.57%).The commonest pathological conditions of the uterus was endometritis which comprised (42.86%) of pathological conditions, followed by freemartin (14.29%), these percentages from abnormal cases. The commonest abnormalities of the ovary were ovarian cysts ...

International Journal of Accounting and Financial Reporting, 2014

Due to academic labor process, the working conditions of universities are changing means now the ... more Due to academic labor process, the working conditions of universities are changing means now the working conditions of universities are becoming standardized. This research paper is qualitative in which researchers tried to explore the concepts that making the academic labor process hectic day by day in the context of Pakistani universities. The aim of this study is to explore that what is the effect of this changing working environment on the lecturers. The convenience sampling method based on self-administrated questionnaires is used to evaluate the effect of different variables on the academic labor process and data collected from the lecturers through interview. Concept analysis technique is used for discussion and conclusion. After allresearch, researchers came to know that HEC policies have a negative effect on university autonomy because according to HEC policies they want more research work in a less time which depressed the lecturers and they create a bad research work. Wor...

Applied Mechanics and Materials, 2012

This article deals with presentation of data processing obtained from imaging CT (computer tomogr... more This article deals with presentation of data processing obtained from imaging CT (computer tomography) and micro CT devices. These methods enable to perform bone tissue density analysis by non-invasive way. The image processing methods, by which it is possible to determine mechanical properties of bone tissue, are described in this paper. Further, a creation of a computational model with different bone density of cancellous tissue is described and afterwards the stress strain analysis is performed. The mandible segments with different bone density were used as samples. Results show significantly higher stresses are reached in a cancellous bone tissue with worse bone quality.

American Journal of Psychiatry, 2011

International Journal of Health Sciences (IJHS), Apr 20, 2022

The current study aims to study some biochemical indicators for thalassemia patients in the Najaf... more The current study aims to study some biochemical indicators for thalassemia patients in the Najaf governorate, and the study included 25 patients with major beta thalassemia during the period from November 2019 to February 2020 and their ages ranged between (2-65) years and 15 healthy people who arenot He had genetic blood diseases and their ages ranged between (2-65) years. The results of the study showed that there are in some biochemical indicators, as there was a significant increase in the level of the enzyme of liver function ALT that was the focus in patients 23.74 ± 29.53 U\L and in healthy people it was 4.61 ± 11.67U\L Also, the creatinine concentration patients 9.92 ± 26.08 mmol\L and in healthy was, 68.06 ± 51.54 mmol\L, Except for urea, we notice that there was a decrease in its concentration in patients 0.89 ± 3.96 mmol\L and in 1624 healthy was 1.03 ± 2.36 mmol\L, There was an increase in the concentration of iron in the blood in patients 382.05 ±64.37 Umol\L And in healthy was 9.48 ± 61.36 Umol\L, as well as a decrease in the concentration of glucose in patients and an increase in healthy people, 18.58 ± 28.59 Umol\L 9.10 ± 20.44 Umol\L respectively. We conclude from this study about some changes that occur on some biochemical indicators for patients with thalassemia that can be attributed to liver and heart diseases, as well as to kidney failure arising from the toxicity of high iron concentration, which is a feature of thalassemia.

NVEO - NATURAL VOLATILES & ESSENTIAL OILS Journal | NVEO, Nov 7, 2021

Journal of City Climate Policy and Economy

This commentary by a youth leader from Pakistan discusses how the Global South has disproportiona... more This commentary by a youth leader from Pakistan discusses how the Global South has disproportionately received the worst impacts of climate change and how, if not stemmed, the effects of climate change will lead to destruction that will render the earth uninhabitable. As warned by climate scientists, global emissions must be drastically reduced to ensure the earth does not heat up beyond 1.5°C. Discrepancies between the abilities of the Global North and Global South to combat and cope with the climate crisis need to be accounted for when international bodies decide on the best strategies to halt the catastrophic impacts of the climate breakdown. The commentary also discusses the historical roots of climate change in colonialism, and voices the youth’s demand for climate justice and climate action.

Zenodo (CERN European Organization for Nuclear Research), Jun 23, 2022

Melia azedarach is a medicinal plant utilized for the treatment of various disorders in Asian cou... more Melia azedarach is a medicinal plant utilized for the treatment of various disorders in Asian countries. The antioxidant potential of fruit-seeds from this plant was investigated using n-hexane, chloroform, methanol and aqueous extracts. Preliminary studies were performed on powder as well as on various extracts. An in vitro anti-oxidant activity was evaluated using DPPH, ABTS and TAC assays. All aforementioned extracts were rich in flavonoids and polyphenols. The aqueous extract (61.30 ± 3.55%) showed high DPPH scavenging activity followed by methanol (52.95% ± 0.53%), chloroform (52.61 ± 3.59%), and n-hexane extract (51.16 ± 1.70%). Similarly, all the extracts exhibited high ABTS scavenging activity. However, in TAC assay, chloroform extract (81.16 ± 1.09%) exhibited the highest inhibitory activity, followed by aqueous, methanol and n-hexane. Therefore, further isolation and characterization of the plant is required to explore the bioactive compounds for their anti-oxidant activity.

Pakistan Journal of Medical and Health Sciences

To analyze the student`s perception of the effectiveness of online versus campus-based teaching. ... more To analyze the student`s perception of the effectiveness of online versus campus-based teaching. A descriptive cross-sectional study was conducted on students of Bachelor of Dental Surgery from College of Dentistry, Sharif Medical and Dental College Lahore. Dental students from all four years were included in the study irrespective of their academic records. Students who did not attend the online classes or refused to give consent were excluded from the study sample. A pre-validated questionnaire with a Cronbach alpha of 0.94 was used. The difference in the mean rank score across different student perceptions of the effectiveness of online in comparison to campus-based teaching was significant for motivational problems and time interruptions (p≤0.001) while non-significant for instructor and personal problems (p=0.437), lack of support services (p=0.942), lack of pre-requisite skills (p=0.218), technical problems (p=0.238) and lack of social interaction (p=0.187). The difference in ...

BackgroundTp53 gene encodes a tumor suppressor protein containing transcriptional activation, DNA... more BackgroundTp53 gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoformsAim of studyThe study is aimed to study the effect of some protein coding SNPs on human health and if it benign or neutral by using different bioinformatics tools (I-MUTANT 3. 0,PROVEAN,and SNPS&GO; PhD-snp)ResultsThe result shows that the protein sequence identification was as the following:MAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDR...

Background:Homo sapiens cell division cycle 73 (CDC73)Enables RNA polymerase II complex binding a... more Background:Homo sapiens cell division cycle 73 (CDC73)Enables RNA polymerase II complex binding activity. Involved in several processes, including histone ubiquitination; negative regulation of cell population proliferation; and regulation of cell cycle G1/S phase transition. Located in cytosol and nucleoplasm. Part of Cdc73/Paf1 complex. Implicated in hyperparathyroidism and parathyroid carcinoma. Biomarker of carcinoma (multiple) and colorectal cancer,This gene encodes a tumor suppressor that is involved in transcriptional and post-transcriptional control pathways. The protein is a component of the the PAF protein complex, which associates with the RNA polymerase II subunit POLR2A and with a histone methyltransferase complex. This protein appears to facilitate the association of 3' mRNA processing factors with actively-transcribed chromatin. Mutations in this gene have been linked to hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid...

Pakistan Journal of Medical and Health Sciences

This study aimed to determine the effectiveness of aromatherapy and music therapy in managing den... more This study aimed to determine the effectiveness of aromatherapy and music therapy in managing dental anxiety and pain among restorative dental patients in Peshawar, Pakistan. Sixty dental patients were selected after strictly following the inclusion and exclusion criteria. Informed consent was taken from the patients and instructed on the study protocols. Two groups were formed. One group had aromatherapy during the dental procedure, and the other had music therapy. The dental anxiety scale revised, present pain intensity and pain severity were used as the measuring tools in the study. SPSS 23 was used for statistical analysis. Chi-square and Mann-Whitney U tests were used for the analysis of the results. The association between pain intensity of dental patients with aromatherapy and music therapy was not significant. The percentage of discomforting pain in patients after aromatherapy was higher than in music therapy, while a higher percentage of patients were completely pain-free a...

Pakistan Journal of Medical and Health Sciences

Objective: To assess the impact of socio-demographic factors on different personality types in in... more Objective: To assess the impact of socio-demographic factors on different personality types in individual. Methodology: A Cross-sectional descriptive study was conducted in College of Dentistry, Sharif Medical and Dental College, Lahore over a period of 5 months from July to November 2021. Data was collected using a ten-item personality inventory scale (TIPI). The sociodemographic variables included age, gender, marital status, occupation and educational level. All individuals irrespective of their age and gender were included in the study. Individuals with a history of psychiatric illness were excluded from the study. Results: There was a statistically significant difference in conscientiousness personality traits among age groups (p=0.006). Similarly, the difference in the personality trait of agreeableness (p≤0.001), conscientiousness (=0.016), and emotional stability (p=0.007) across gender was statistically significant. There was also a statistically significant difference in t...

Pakistan Journal of Medical and Health Sciences

Objective: This study aimed to evaluate the association and psychological profile, including depr... more Objective: This study aimed to evaluate the association and psychological profile, including depression, anxiety, stress, and personality type (Type A and Type B), with the academic performance of the medical students. Methodology: It was a cross-sectional study conducted at different medical colleges in Peshawar. The data was collected from the final year students of MBBS. A total of 325 students participated in the study. Informed consent was taken from the participants. The academic performance (Success and failure) was documented through the annual result sheets of the students. Jenkin's Personality Survey Questionnaire evaluated personality types, and Depression Anxiety Stress Scale-21 (DASS-21) was used to assess stress, anxiety, and depression. The data was entered and analyzed on SPSS 26. Results: Out of 325 students, 199 were male, and 126 were female. Type A personality students (88.8%) had a high success percentage of academic performance as compared to Type B persona...

˜Al-œKhawarizmi engineering journal, 2011

A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-... more A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-T6 (Al-Mg-Zn), adopting friction stir welding (FSW) technique and conventional metal inert gas (MIG) technique, is well achieved in this work for real comparison purposes. The essences of present output findings were concentrated upon the FSW samples in respect to that MIG ones which can be summarized in the increase of the ultimate tensile strength for FSW was 340 MPa while it was 232 MPa for MIG welding, where it was for base metal 400 MPa. The minimum microhardness value for FSW was recorded at HAZ and it was 133 HV0.05 while it was 70 HV0.05 for MIG weld at the welding metal. The FSW produce 2470 N higher than MIG welding in the bending test and a decrease in the localized grain size for FSW in the stirred zone 12 µm and it was 37 µm for MIG while it was 32 µm for the base metal.

Journal of Rehman College of Dentistry, 2021

Objectives: To evaluate the detrimental impact of smoking on oral health.Methodology: A Cross sec... more Objectives: To evaluate the detrimental impact of smoking on oral health.Methodology: A Cross sectional comparative study was carried out on 100 patients, 50 smokers and 50 non-smokers, visitingSharif Medical and Dental College, Lahore from June 2019 to July 2020. Intra-oral examination was done using the CommunityPeriodontal Index of Treatment Needs (CPITN). Recorded data was coded, entered and analyzed using SPSS statistical Packageversion 23.ResultsThe periodontal health was significantly associated with status of smoking (p=0.001). The most prevalent periodontal problemsof smokers were periodontal pockets of 4 to 5 mm (19%) while the least (4%) had bleeding on probing. Majority of the nonsmokers(32%) had bleeding on probing. The number of cigarettes smoked in a day and periodontal health status weresignificantly associated (p=0.004). Light smokers (1 to 10 cigarettes/day) had periodontal pockets of 4 to 5mm as their biggestperiodontal problems (38%) while the least (8%) had blee...

Al-Khawarizmi Engineering Journal, 2011

A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-... more A comprehensive practical study of typical mechanical properties of welded Aluminum alloy AA7020-T6 (Al-MgZn), adopting friction stir welding (FSW) technique and conventional metal inert gas (MIG) technique, is well achieved in this work for real comparison purposes. The essences of present output findings were concentrated upon the FSW samples in respect to that MIG ones which can be summarized in the increase of the ultimate tensile strength for FSW was 340 MPa while it was 232 MPa for MIG welding, where it was for base metal 400 MPa. The minimum microhardness value for FSW was recorded at HAZ and it was 133 HV0.05 while it was 70 HV0.05 for MIG weld at the welding metal. The FSW produce 2470 N higher than MIG welding in the bending test and a decrease in the localized grain size for FSW in the stirred zone 12 µm and it was 37 µm for MIG while it was 32 µm for the base metal. Keyword: FSW friction, stir welding, solid state, MIG metal inert gas, fusion, mechanical properties.

Basrah Journal of Veterinary Research, 2010

In this study 15 rabbits were divided into three groups ,each group contain five rabbit were subm... more In this study 15 rabbits were divided into three groups ,each group contain five rabbit were submitted to surgical section in the skin layer 3-5 cm long after anasethesia and cleaning the part from the hair by sheaving. The surgical section was made by scable and then the wound sutured by silk band 2.5 cm and then administrated the dexamethasone 1 mg / Kg body weight of animals of second and third grougs of this study. After that the skin spicemen were taken for histopathological sections to preperd slid. The first group was considered as control with no administrated of dexamthasone , the second group treated as 1 mg / Kg body weight dexamthasone and sections were taken after 7th days , the third group were also treated with dexamthasone at the 1 mg /Kg and the skin sample were taken after 14 th days. The present study it was found that dexamthasone have no effect on the wound healing after 7th days or 14th days but the collagenization , epithelization and fibroblast content were less in the dexamthasone group compered with control group. The vasicularity and the degree of inflammatory cells were more intense in the dexamthasone group compared with control group.

Journal of Gandhara Medical and Dental Science, 2019

OBJECTIVES: The study aim was to determine the feedback regarding the environment, satisfaction a... more OBJECTIVES: The study aim was to determine the feedback regarding the environment, satisfaction and further needs for modification in improving the effectiveness of the lecture. METHODOLOGY: It was a cross-sectional study to measure the student's feedback about lecture rooms to improve the effectiveness of the lectures. A questionnaire was designed to assess the student's response about the environment of the lecture room, the learning experience of the students, needs of other lecture rooms’ modification, seating design and temperature of the lecture room. The total numbers of the participants were 115 students including both genders from Sardar Begum Dental College, Peshawar. Second- and fourth-year professional students were excluded from the study. Responses were recorded from 115 participants of the first- and third-year students of BDS. The obtained data were analyzed using SPSS 20. RESULTS:This study results showed that 100% of the students were satisfied with the env...

IOP Conference Series: Materials Science and Engineering, 2019

The aimed of study to examined female reproductive system grossly and histopathological to study ... more The aimed of study to examined female reproductive system grossly and histopathological to study of lesion causes infertility or sterility in ewes. This study was conducted on the genital tract of 80 ewes in Basra province. The specimen were randomly collected from Basra slaughter house of different areas of Basra city (Qurna, Zubear, Karma Ali, Abu AL khasab, Hayaniya, alder, Shatt al-Arab)within the period from October 2014 to January 2015.The gross examination of collected specimen was confirmed histologically, pathological changes were found in 28 (35%) of the total cases. and 52 (65%) samples normal. Uterine abnormalities comprised (57.14%), whereas ovarian abnormalities comprised (39.29%) and oviduct abnormalities were (3.57%).The commonest pathological conditions of the uterus was endometritis which comprised (42.86%) of pathological conditions, followed by freemartin (14.29%), these percentages from abnormal cases. The commonest abnormalities of the ovary were ovarian cysts ...

International Journal of Accounting and Financial Reporting, 2014

Due to academic labor process, the working conditions of universities are changing means now the ... more Due to academic labor process, the working conditions of universities are changing means now the working conditions of universities are becoming standardized. This research paper is qualitative in which researchers tried to explore the concepts that making the academic labor process hectic day by day in the context of Pakistani universities. The aim of this study is to explore that what is the effect of this changing working environment on the lecturers. The convenience sampling method based on self-administrated questionnaires is used to evaluate the effect of different variables on the academic labor process and data collected from the lecturers through interview. Concept analysis technique is used for discussion and conclusion. After allresearch, researchers came to know that HEC policies have a negative effect on university autonomy because according to HEC policies they want more research work in a less time which depressed the lecturers and they create a bad research work. Wor...

Applied Mechanics and Materials, 2012

This article deals with presentation of data processing obtained from imaging CT (computer tomogr... more This article deals with presentation of data processing obtained from imaging CT (computer tomography) and micro CT devices. These methods enable to perform bone tissue density analysis by non-invasive way. The image processing methods, by which it is possible to determine mechanical properties of bone tissue, are described in this paper. Further, a creation of a computational model with different bone density of cancellous tissue is described and afterwards the stress strain analysis is performed. The mandible segments with different bone density were used as samples. Results show significantly higher stresses are reached in a cancellous bone tissue with worse bone quality.

American Journal of Psychiatry, 2011

International Journal of Health Sciences (IJHS), Apr 20, 2022

The current study aims to study some biochemical indicators for thalassemia patients in the Najaf... more The current study aims to study some biochemical indicators for thalassemia patients in the Najaf governorate, and the study included 25 patients with major beta thalassemia during the period from November 2019 to February 2020 and their ages ranged between (2-65) years and 15 healthy people who arenot He had genetic blood diseases and their ages ranged between (2-65) years. The results of the study showed that there are in some biochemical indicators, as there was a significant increase in the level of the enzyme of liver function ALT that was the focus in patients 23.74 ± 29.53 U\L and in healthy people it was 4.61 ± 11.67U\L Also, the creatinine concentration patients 9.92 ± 26.08 mmol\L and in healthy was, 68.06 ± 51.54 mmol\L, Except for urea, we notice that there was a decrease in its concentration in patients 0.89 ± 3.96 mmol\L and in 1624 healthy was 1.03 ± 2.36 mmol\L, There was an increase in the concentration of iron in the blood in patients 382.05 ±64.37 Umol\L And in healthy was 9.48 ± 61.36 Umol\L, as well as a decrease in the concentration of glucose in patients and an increase in healthy people, 18.58 ± 28.59 Umol\L 9.10 ± 20.44 Umol\L respectively. We conclude from this study about some changes that occur on some biochemical indicators for patients with thalassemia that can be attributed to liver and heart diseases, as well as to kidney failure arising from the toxicity of high iron concentration, which is a feature of thalassemia.

NVEO - NATURAL VOLATILES & ESSENTIAL OILS Journal | NVEO, Nov 7, 2021