Complete amino acid sequence of the FK506 and rapamycin binding protein, FKBP, isolated from calf thymus - PubMed (original) (raw)

Complete amino acid sequence of the FK506 and rapamycin binding protein, FKBP, isolated from calf thymus

W S Lane et al. J Protein Chem. 1991 Apr.

Abstract

FKBP, an 11.8 kD intracellular protein that binds the immunosuppressants FK506 (Kd = 0.4 nM) and rapamycin (Kd = 0.2 nM) with high affinity, was purified to homogeneity from calf thymus. The complete amino acid sequence has been determined by automated Edman degradation of the intact molecule and overlapping fragments generated by proteolytic and chemical cleavage. The analysis revealed a 107 amino acid peptide chain with the following sequence: GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFV- LGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE. The molecular weight, calculated from the amino acid sequence to be 11,778 D, was confirmed by electrospray ionization mass spectrometry. Thus, naturally isolated bovine FKBP does not appear to have any residues modified by glycosylation, phosphorylation, or other posttranslational derivatization processes. Bovine FKBP has only three amino acid residues that differ from human FKBP, whose sequence was elucidated by cloning and sequencing complementary DNA (Standaert et al., 1990). The protein has a substantial number of hydrophilic peptide segments with prevalent beta-strand type of chain fold. Understanding the biological function of FKBP and other members of the immunophilin class and their respective complexes with immunosuppressive drugs may provide insights into cytoplasmic signalling mechanisms, protein folding and translocation, and other cellular processes.

PubMed Disclaimer

Similar articles

• Atomic structures of the human immunophilin FKBP-12 complexes with FK506 and rapamycin.
  Van Duyne GD, Standaert RF, Karplus PA, Schreiber SL, Clardy J. Van Duyne GD, et al. J Mol Biol. 1993 Jan 5;229(1):105-24. doi: 10.1006/jmbi.1993.1012. J Mol Biol. 1993. PMID: 7678431
• Molecular cloning of a membrane-associated human FK506- and rapamycin-binding protein, FKBP-13.
  Jin YJ, Albers MW, Lane WS, Bierer BE, Schreiber SL, Burakoff SJ. Jin YJ, et al. Proc Natl Acad Sci U S A. 1991 Aug 1;88(15):6677-81. doi: 10.1073/pnas.88.15.6677. Proc Natl Acad Sci U S A. 1991. PMID: 1713687 Free PMC article.
• Molecular characterization of a FKBP-type immunophilin from higher plants.
  Luan S, Kudla J, Gruissem W, Schreiber SL. Luan S, et al. Proc Natl Acad Sci U S A. 1996 Jul 9;93(14):6964-9. doi: 10.1073/pnas.93.14.6964. Proc Natl Acad Sci U S A. 1996. PMID: 8692927 Free PMC article.
• The chemistry of signal transduction.
  Clardy J. Clardy J. Proc Natl Acad Sci U S A. 1995 Jan 3;92(1):56-61. doi: 10.1073/pnas.92.1.56. Proc Natl Acad Sci U S A. 1995. PMID: 7529414 Free PMC article. Review.
• Three-dimensional structure and actions of immunosuppressants and their immunophilins.
  Braun W, Kallen J, Mikol V, Walkinshaw MD, Wüthrich K. Braun W, et al. FASEB J. 1995 Jan;9(1):63-72. doi: 10.1096/fasebj.9.1.7529736. FASEB J. 1995. PMID: 7529736 Review.

Cited by

• Cyclophilins and cyclophilin inhibitors in nidovirus replication.
  de Wilde AH, Pham U, Posthuma CC, Snijder EJ. de Wilde AH, et al. Virology. 2018 Sep;522:46-55. doi: 10.1016/j.virol.2018.06.011. Epub 2018 Jul 12. Virology. 2018. PMID: 30014857 Free PMC article. Review.
• CCR3 and choroidal neovascularization.
  Li Y, Huang D, Xia X, Wang Z, Luo L, Wen R. Li Y, et al. PLoS One. 2011 Feb 15;6(2):e17106. doi: 10.1371/journal.pone.0017106. PLoS One. 2011. PMID: 21358803 Free PMC article.
• Rapamycin-resistant mTORC1 kinase activity is required for herpesvirus replication.
  Moorman NJ, Shenk T. Moorman NJ, et al. J Virol. 2010 May;84(10):5260-9. doi: 10.1128/JVI.02733-09. Epub 2010 Feb 24. J Virol. 2010. PMID: 20181700 Free PMC article.
• Cell-based assays for high-throughput screening.
  An WF, Tolliday N. An WF, et al. Mol Biotechnol. 2010 Jun;45(2):180-6. doi: 10.1007/s12033-010-9251-z. Mol Biotechnol. 2010. PMID: 20151227 Review.
• Transmembrane transforming growth factor-alpha tethers to the PDZ domain-containing, Golgi membrane-associated protein p59/GRASP55.
  Kuo A, Zhong C, Lane WS, Derynck R. Kuo A, et al. EMBO J. 2000 Dec 1;19(23):6427-39. doi: 10.1093/emboj/19.23.6427. EMBO J. 2000. PMID: 11101516 Free PMC article.

References

1. 1. J Antibiot (Tokyo). 1987 Sep;40(9):1249-55 - PubMed
2. 1. J Antibiot (Tokyo). 1987 Sep;40(9):1256-65 - PubMed
3. 1. J Chromatogr. 1989 Aug 4;476:363-75 - PubMed
4. 1. Int Arch Allergy Appl Immunol. 1983;70(4):289-94 - PubMed
5. 1. Nature. 1986 Nov 27-Dec 3;324(6095):383-5 - PubMed

Publication types

MeSH terms

Substances

LinkOut - more resources

• Other Literature Sources

  • The Lens - Patent Citations Database