Structural Classification of Proteins — extended (original) (raw)

PDB entry 1hzg

View 1hzg on RCSB PDB site Description: crystal structure of the inactive c866s mutant of the catalytic domain of e. coli cytotoxic necrotizing factor 1
Class: toxin
Keywords: Beta Sandwich, Rho Deamidase, Rho Transglutaminase, TOXIN
Deposited on 2001-01-24, released 2001-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytotoxic necrotizing factor 1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47106 (0-294)
    * see remark 999 (74)
    * engineered (146)

Domains in SCOPe 2.08: d1hzga_

• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)

  1hzgA (A:)
  siestsksnfqklsrgnidvlkgrgsisstrqraiypyfeaanadeqqplffyikkdrfd
  nhgydqyfydntvgpngiptlntytgeipsdssslgstywkkynltnetsiirvsnsarg
  angikialeevqegkpviitsgnlsgsttivarkegyiykvhtgttkslagftsttgvkk
  avevlelltkepiprvegimsndflvdylsenfedslitysssekkpdsqitiirdnvsv
  fpyfldnipehgfgtsatvlvrvdgnvvvrslsesyslnadaseisvlkvfskkf