| dbo:abstract |
Das SBP-Tag (von englisch Streptavidin binding peptide tag) ist ein Protein-Tag, das in der Biochemie zur Proteinreinigung und zum -nachweis verwendet wird. (de) The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. (en) |
| dbo:wikiPageID |
25395887 (xsd:integer) |
| dbo:wikiPageLength |
16373 (xsd:nonNegativeInteger) |
| dbo:wikiPageRevisionID |
1077305716 (xsd:integer) |
| dbo:wikiPageWikiLink |
dbr:Protein_A dbr:Proteins dbr:Endoplasmic_reticulum dbr:Biotin dbr:Protein_G dbr:MRNA_Display dbc:Amino_acids dbr:Strep-tag dbr:Condensin dbr:Sigma-Aldrich dbr:Streptavidin dbr:Protein_tag dbr:Dissociation_constant dbr:Agilent_Technologies dbr:Amino_acid dbr:Dengue_Virus dbr:Hepatoma-derived_growth_factor dbr:Recombinant_DNA dbc:Peptides dbc:Protein_methods dbr:Affinity_chromatography dbc:Biochemical_separation_processes dbr:Tafazzin dbr:Green_fluorescent_protein dbr:Bruton's_tyrosine_kinase dbr:Surface_plasmon_resonance dbr:Wnt_signaling_pathway dbr:FLAG-tag dbr:Polyhistidine-tag dbr:Protein_phosphatase_2A dbr:Tandem_Affinity_Purification |
| dbp:wikiPageUsesTemplate |
dbt:Protein_tag dbt:Citation_needed dbt:Cite_journal dbt:Reflist dbt:Abbreviations |
| dcterms:subject |
dbc:Amino_acids dbc:Peptides dbc:Protein_methods dbc:Biochemical_separation_processes |
| gold:hypernym |
dbr:Sequence |
| rdf:type |
yago:WikicatAminoAcids yago:Abstraction100002137 yago:Amide114724264 yago:AminoAcid114601829 yago:Chemical114806838 yago:Compound114818238 yago:Macromolecule114944888 yago:Material114580897 yago:Matter100020827 yago:Molecule114682133 yago:OrganicCompound114727670 yago:Part113809207 yago:Peptide114743046 yago:PhysicalEntity100001930 yago:Protein114728724 yago:Relation100031921 yago:Substance100019613 yago:Thing100002452 yago:Unit109465459 yago:WikicatPeptides yago:WikicatProteins |
| rdfs:comment |
Das SBP-Tag (von englisch Streptavidin binding peptide tag) ist ein Protein-Tag, das in der Biochemie zur Proteinreinigung und zum -nachweis verwendet wird. (de) The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. (en) |
| rdfs:label |
SBP-Tag (de) SBP-tag (en) |
| owl:sameAs |
freebase:SBP-tag yago-res:SBP-tag wikidata:SBP-tag dbpedia-de:SBP-tag https://global.dbpedia.org/id/4uwfv |
| prov:wasDerivedFrom |
wikipedia-en:SBP-tag?oldid=1077305716&ns=0 |
| foaf:isPrimaryTopicOf |
wikipedia-en:SBP-tag |
| is dbo:wikiPageDisambiguates of |
dbr:SBP |
| is dbo:wikiPageRedirects of |
dbr:SBP_tag |
| is dbo:wikiPageWikiLink of |
dbr:Protein_tag dbr:SBP dbr:SBP_tag |
| is foaf:primaryTopic of |
wikipedia-en:SBP-tag |